NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022774

3300022774: Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R7 Version 2



Overview

Basic Information
IMG/M Taxon OID3300022774 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120440 | Gp0149068 | Ga0242725
Sample NameMicrobial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R7 Version 2
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of New South Wales
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size98395081
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSponge Microbes In A High Co2 World
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationDavies Reef, Great Barrier Reef, Australia
CoordinatesLat. (o)-18.833Long. (o)147.683Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027335Metagenome / Metatranscriptome195Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0242725_158604Not Available729Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0242725_158604Ga0242725_1586043F027335GFDPPEYNLTLAENMIIALEINHHPVKLEHLLRVTADGAEILSTYPMEPELAPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.