| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300022541 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111485 | Gp0127788 | Ga0212117 |
| Sample Name | Gongxiaoshe_combined assembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 126182832 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Gongxiaoshe hot spring | |||||||
| Coordinates | Lat. (o) | 25.4401 | Long. (o) | 98.4408 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045123 | Metagenome / Metatranscriptome | 153 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0212117_1008769 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0212117_1008769 | Ga0212117_10087691 | F045123 | MRRRAKPSGKPTTRVRQILTQLGYVEHEDFEYEVEIRLYSNRRLYADVMLFQGDAPIAVVEVEGKPSLLREGFEEARFKGAAWNLENPVPLLWVAAGERDALYRLTRPCNGICYAPLSEQTLPQALAPAQLATLIGDYLQQTDAPLGQSLRDRNLLRDALQA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |