NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022371

3300022371: Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_9 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022371 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132838 | Gp0267158 | Ga0232065
Sample NameMetatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_9 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size53836312
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAnaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: California
CoordinatesLat. (o)37.8719Long. (o)-122.2585Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024166Metagenome / Metatranscriptome207Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0232065_119220Not Available621Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0232065_119220Ga0232065_1192202F024166VRSRFERAWARGFEIAEEVGGPDGDDVRYRIRRRSDGSVLPALFTVDDVREEKRDRLWWI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.