NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300022361

3300022361: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.378 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300022361 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114516 | Gp0225721 | Ga0210337
Sample NameMetatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.378 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size16463678
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEstuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Alternative Ecosystem Assignments
Environment Ontology (ENVO)estuarine biomeestuarysediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Washington
CoordinatesLat. (o)46.313Long. (o)-123.997Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006508Metagenome / Metatranscriptome371Y
F030135Metagenome / Metatranscriptome186Y
F053305Metagenome / Metatranscriptome141Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0210337_103149Not Available751Open in IMG/M
Ga0210337_105249Not Available609Open in IMG/M
Ga0210337_107493Not Available530Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0210337_103149Ga0210337_1031492F030135EEFAKLSSTSDIWHSTFIGCQLPDAILPGTEAFDLVAGPLD
Ga0210337_105249Ga0210337_1052493F006508VAVANAPLKAVADQSQVVKTRRPNRRRVLTWFASRWRNHQPKRAEKPHS
Ga0210337_107493Ga0210337_1074931F053305MLKKSLSIVLTALFVFSFIAVGTVSAAEVKGEVVSVNAETGEMVIKDDAGEMKTLMADPKVVDLKMLKEGDMVSVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.