Sample 3300021969

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300021969

3300021969: Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_7 (Metagenome Metatranscriptome)

Overview

Basic Information
IMG/M Taxon OID	3300021969 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0132838 \| Gp0267156 \| Ga0232063
Sample Name	Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_7 (Metagenome Metatranscriptome)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	116416546
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR30	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States
Type	Engineered
Taxonomy	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	na → na → na

Location Information
Location	USA: California
Coordinates	Lat. (^o)	37.8719	Long. (^o)	-122.2585	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000344	Metagenome / Metatranscriptome	1257	Y
F027556	Metagenome / Metatranscriptome	194	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0232063_1150340	Not Available	811	Open in IMG/M
Ga0232063_1160829	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR30	620	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0232063_1150340	Ga0232063_11503402	F000344	MRPRSAPAALSGVGEHTARESESAQCCAAGKERVANAH
Ga0232063_1160829	Ga0232063_11608292	F027556	MPTIITFTPLQPPSRLHIKGRGRLLTHCCEDATGHKHRQRLPVGSVRGIMYLDALCLHCGAHLVWVDEDVPDIGPPMGGTTAS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.