NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300021326

3300021326: Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Alfalfa, Gen10, Rep 3



Overview

Basic Information
IMG/M Taxon OID3300021326 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118397 | Gp0242251 | Ga0214518
Sample NameEnriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Alfalfa, Gen10, Rep 3
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size248170111
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDetermining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)34.4149Long. (o)-119.841Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F106163Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0214518_147545Not Available538Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0214518_147545Ga0214518_1475451F106163SNVEIGESWLCRLVFKDESFKDYVVTADVLYAGEDTSSRYKMVFYMPEGWDNSYPIFLDRYVPCDGPAWQAYQGMPVAEAALKEGNMIVVLVAYSEWTAIPDILLAEAFLKQHDADLPGDSRNILTAADFDFETAAYYDFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.