Basic Information | |
---|---|
IMG/M Taxon OID | 3300019060 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129055 | Gp0214181 | Ga0188853 |
Sample Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_3p0 |
Sequencing Status | Permanent Draft |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 3062186 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Baltic Sea | |||||||
Coordinates | Lat. (o) | 56.1664 | Long. (o) | 16.378218 | Alt. (m) | N/A | Depth (m) | 4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078928 | Metagenome / Metatranscriptome | 116 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0188853_100067 | Ga0188853_1000671 | F078928 | RPVIVIRLTIGRHRGAKRMIREAQKNSDEMSEDVYWDRLDSANHLADECKARIQQIFNDTFGG |
⦗Top⦘ |