| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300018606 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117946 | Gp0216917 | Ga0193025 |
| Sample Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002509 (ERX1782176-ERR1711960) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 49053256 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota | 2 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | oceanic mesopelagic zone biome → marine mesopelagic zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Atlantic Ocean: TARA_149 | |||||||
| Coordinates | Lat. (o) | 34.0771 | Long. (o) | -49.8233 | Alt. (m) | N/A | Depth (m) | 740 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082240 | Metagenome / Metatranscriptome | 113 | Y |
| F101336 | Metagenome / Metatranscriptome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0193025_1002965 | All Organisms → cellular organisms → Eukaryota | 1339 | Open in IMG/M |
| Ga0193025_1008950 | All Organisms → cellular organisms → Eukaryota | 717 | Open in IMG/M |
| Ga0193025_1011474 | Not Available | 623 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0193025_1002965 | Ga0193025_10029651 | F082240 | VAQGLLLDLDAATMTVWVNGERKGVMVRPGMTVDSEDDSHGEPVARLDGPLRWAVEMASTSTRPWSVTIGGPLPPPA |
| Ga0193025_1008950 | Ga0193025_10089501 | F082240 | MRVSQGLLLDLDAATVWVNGVRKGVMVRPSMTDVDGEPVGRLEGPLRWAVALGPNASVEIAGALSPPA |
| Ga0193025_1011474 | Ga0193025_10114741 | F101336 | IFKHNLFTPTNIALVGEPSLTSVDPFVSKGTAKTSFCGNSPQATY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |