NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018562

3300018562: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000700 (ERX1782139-ERR1712148)



Overview

Basic Information
IMG/M Taxon OID3300018562 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117946 | Gp0216983 | Ga0193150
Sample NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000700 (ERX1782139-ERR1712148)
Sequencing StatusPermanent Draft
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28186267
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomedeep chlorophyll maximum layersea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationMediterranean Sea: TARA_022
CoordinatesLat. (o)39.8607Long. (o)17.4105Alt. (m)N/ADepth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000021Metagenome / Metatranscriptome6082Y
F025213Metatranscriptome202Y
F063744Metatranscriptome129N
F088751Metagenome / Metatranscriptome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193150_1000579Not Available1343Open in IMG/M
Ga0193150_1003569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis722Open in IMG/M
Ga0193150_1006661All Organisms → cellular organisms → Eukaryota570Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193150_1000579Ga0193150_10005792F088751MPIFGPKCQFWAKFGRFWAPNPIFWGQGVKILVPSYRDSNETPFSCXKHXSVRLQLAARGENVLFXPQNLDIWGQKSIFCLVIAIFVDGTNDHYTRGYNFPIGTTPKKISVSELGVIFWGSPLFLAVFGHSHVRRATTLNFGPISTKLGGIVRAIKKMTQKDNGPGPGRNYGETGVFTFGRKVVFGLKMGLTPKNHPKXHFPP
Ga0193150_1001792Ga0193150_10017921F000021KNNADKIIDLNGTKKTGGTGIKQLRENIAESKLSYEIMDDAAQAFLKSKIMDNIHKYFYIIVFAAYMRDAAAKAREAVDAEKKAAVALPASGKCSIPAKELKIEGSFVDFVAKVGGLHELIDTGKGNLQWERDIPPAALSNLEGLANSDFKSNLGKIIHDIYQTAHLMFADMPQGDHKKRAKYRFASKTLMRILPPAAKTEVEGLIEKKKISLDLYEILGVCTWVEPK
Ga0193150_1003569Ga0193150_10035691F025213MEKTDAEKIMEEILSMQAGLNPDQQADANEEAEMIIRAIMQDEVDNSVYSKMADDLEAASKRVKKRKVKKVKESASEISA
Ga0193150_1006661Ga0193150_10066611F063744SAAPQIVPYDHVEIAAEPYVHQEIPAEPYVHEEPELTPEALGIINRSQRPQAVPTAAPVVAPQQFAGPVQQFVPQQQQFAQFAAPQQFAQFAAPVQGVQGVWTGGCYNNLGEGVPCRQKF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.