Sample 3300018547

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300018547

3300018547: Metatranscriptome of marine microbial communities from Baltic Sea - GS675_0p1

Overview

Basic Information
IMG/M Taxon OID	3300018547 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0129055 \| Gp0214159 \| Ga0188831
Sample Name	Metatranscriptome of marine microbial communities from Baltic Sea - GS675_0p1
Sequencing Status	Permanent Draft
Sequencing Center	J. Craig Venter Institute (JCVI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	2601378
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Metatranscriptome Of Marine Microbial Communities From Baltic Sea
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Baltic Sea
Coordinates	Lat. (^o)	62.09708	Long. (^o)	18.5427	Alt. (m)	N/A	Depth (m)	.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008184	Metagenome / Metatranscriptome	337	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0188831_100520	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	621	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0188831_100520	Ga0188831_1005202	F008184	MAYTDLFNEAIDDLTASLTAVSGLRVVNDATKIVPNCVFIDAPSFTTMAGNGNVIRLEFPIRVIGSGPAGLP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.