| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300018544 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129055 | Gp0214185 | Ga0188857 |
| Sample Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1319541 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 54.570232 | Long. (o) | 11.332183 | Alt. (m) | N/A | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063493 | Metagenome / Metatranscriptome | 129 | N |
| F078928 | Metagenome / Metatranscriptome | 116 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0188857_100050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 920 | Open in IMG/M |
| Ga0188857_100059 | Not Available | 865 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0188857_100050 | Ga0188857_1000502 | F078928 | AKRMIREAQKGKDEQMEDVYWDRMDTANRLADDCKARIQHIFNDTFGA |
| Ga0188857_100059 | Ga0188857_1000592 | F063493 | MQTIFLIVLAVAIVGYLVMNREGLRWDRGFAGFRPAVTGVITEGNLEITGNPVEDVAIKALMIKKIVDATTEEIFRTKGLKMFPIETIFIQVFDSPDKIKELKQKRPDVYDAYVKFLQARDKDAVLTRNGDGTEQEQLARTALINYLEALKRDQDYNTVPDNVPATYRCRPIVSRITI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |