Sample 3300017919

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300017919

3300017919: Subsurface microbial communities from deep shales in Ohio, USA - hydraulic fracturing test GB_TM_B

Overview

Basic Information
IMG/M Taxon OID	3300017919 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118431 \| Gp0208777 \| Ga0182235
Sample Name	Subsurface microbial communities from deep shales in Ohio, USA - hydraulic fracturing test GB_TM_B
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	29469814
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → planetary subsurface zone → fracking liquid
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	USA: Ohio
Coordinates	Lat. (^o)	40.178	Long. (^o)	-81.073	Alt. (m)	N/A	Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087432	Metagenome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0182235_100107	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	28626	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0182235_100107	Ga0182235_10010726	F087432	MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFEQITFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPEGYEHPLSDLKLKKERLQHQNDIDEAYQTILESEGLI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.