NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017576

3300017576: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 15 C, 28 psu salinity and 329 ?mol photons light - Alexandrium fundyense CCMP 1719 (MMETSP0196) (SRX549001-SRR1294387)



Overview

Basic Information
IMG/M Taxon OID3300017576 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212255 | Ga0187702
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 15 C, 28 psu salinity and 329 ?mol photons light - Alexandrium fundyense CCMP 1719 (MMETSP0196) (SRX549001-SRR1294387)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size965007
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Sar1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)43.1Long. (o)70.782Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001618Metagenome / Metatranscriptome662Y
F019947Metatranscriptome226Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0187702_10279All Organisms → cellular organisms → Eukaryota661Open in IMG/M
Ga0187702_10323All Organisms → cellular organisms → Eukaryota → Sar618Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0187702_10279Ga0187702_102791F019947MVVDSLPEDKPKILFYAAMMWVQNFGFFLMYFMMFQSIPDPSGGECTNLRNWVGFFALDCFVESFVCVWMGMGGYTSDACMFPVMWILHLVVALPYVLCTVTIPLAIYSDDGSTCREHAGAPLYPLVPVYWTHASLFLVYVWMMLSITYFSFLKPTFFSSPYKAQNNS
Ga0187702_10323Ga0187702_103231F001618MWRPDAGPCVAQVAEWGSHPDDVEYMRLLKAMPKKILKRREIICKDSALEKATQKQGKVHFSICVWNLSEYSKSSGLGDEASSMAHVFYESKDERKVLNAFSSAGIDLESAEAVPVDPNSSLPHEQNIMYTKENLYLQDLYTWEEGSPLTADDLKSRFKMK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.