Sample 3300017267

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300017267

3300017267: Metatranscriptome of marine eukaryotic communities from Gulf of California (Sea of Cort?s) in ASW medium, resuspended in ASW with 2.5 mg/L nocodazole, 20 C and 204 ?mol photons light - Extubocellulus spinifer CCMP 396 (MMETSP0699)

Overview

Basic Information
IMG/M Taxon OID	3300017267 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0128947 \| Gp0212152 \| Ga0186440
Sample Name	Metatranscriptome of marine eukaryotic communities from Gulf of California (Sea of Cort?s) in ASW medium, resuspended in ASW with 2.5 mg/L nocodazole, 20 C and 204 ?mol photons light - Extubocellulus spinifer CCMP 396 (MMETSP0699)
Sequencing Status	Permanent Draft
Sequencing Center	National Center for Genome Resources
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	39716199
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Ostreococcus → Ostreococcus mediterraneus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Gulf of California (Sea of Cort?s)
Coordinates	Lat. (^o)	31.3172	Long. (^o)	-113.56	Alt. (m)	N/A	Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008555	Metatranscriptome	331	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0186440_114457	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Ostreococcus → Ostreococcus mediterraneus	783	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186440_114457	Ga0186440_1144572	F008555	AANTAEVSTSDVRKGAAFDNIKASWGKSLNVGDFKTNLRCNYDYNENRDFLKDVNLQGNLMEGSGDDLQLAYDVKHNFKTKNTEVKLSATTQGTTLAAEYDTDSKLKEVSASRSVDVADYKVDLRPSWLVQAKTARVKMMSALGGNKDRISAQVDYNTDAGSAAYELGYSRSLEDGKEVSATFSPNDNELEVQYVDSKFENGATWTAKATVDTSDRNILEATKVTLKRAWSW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.