NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017229

3300017229: Metatranscriptome of marine eukaryotic communities from Gulf of California (Sea of Cort?s) in ASW medium, 20 C and 649 ?mol photons light - Extubocellulus spinifer CCMP 396 (MMETSP0696)



Overview

Basic Information
IMG/M Taxon OID3300017229 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212155 | Ga0186443
Sample NameMetatranscriptome of marine eukaryotic communities from Gulf of California (Sea of Cort?s) in ASW medium, 20 C and 649 ?mol photons light - Extubocellulus spinifer CCMP 396 (MMETSP0696)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size40690988
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationGulf of California (Sea of Cort?s)
CoordinatesLat. (o)31.3172Long. (o)-113.56Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067805Metagenome / Metatranscriptome125Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186443_120449All Organisms → cellular organisms → Eukaryota → Sar596Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186443_120449Ga0186443_1204491F067805MGGKSKKEEEVTLSKKDLKKVTKLEAQIPYHMGRGETEEAEKIKAKIDAIWEKAKEAAYA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.