NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017008

3300017008: Metatranscriptome of marine eukaryotic communities from North Sea in K medium, 14 C, 21 psu salinity and 372 ?mol photons light - Asterionellopsis glacialis CCMP 1581 (MMETSP1394)



Overview

Basic Information
IMG/M Taxon OID3300017008 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212062 | Ga0186350
Sample NameMetatranscriptome of marine eukaryotic communities from North Sea in K medium, 14 C, 21 psu salinity and 372 ?mol photons light - Asterionellopsis glacialis CCMP 1581 (MMETSP1394)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23527866
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Sea
CoordinatesLat. (o)51.7333Long. (o)3.7667Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078213Metagenome / Metatranscriptome116Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186350_109315All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta956Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186350_109315Ga0186350_1093152F078213MEFATQLNIDPSQCFGDEGGIVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGIQNLAPKKIGDTLRQGGTFVFRGDKTLFQHFDSKVGDNADIDAILASI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.