NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016991

3300016991: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with Sargasso seawater w/o nitrate, 14 C, 36 psu salinity and 101 ?mol photons light - Ditylum brightwellii GSO105 (MMETSP1001)



Overview

Basic Information
IMG/M Taxon OID3300016991 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212030 | Ga0186318
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with Sargasso seawater w/o nitrate, 14 C, 36 psu salinity and 101 ?mol photons light - Ditylum brightwellii GSO105 (MMETSP1001)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28711313
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)47.74Long. (o)-122.417Alt. (m)N/ADepth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081743Metagenome / Metatranscriptome114Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186318_110567All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1061Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186318_110567Ga0186318_1105672F081743MHSLDHALMDWNLEDPLWLDVDDPKYGKMAEIGRIIKVGFVPEVGGYYFHRKWKGSGHPFYEAVYRKLVKIDRKFADAMDTCICR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.