x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016991
3300016991: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with Sargasso seawater w/o nitrate, 14 C, 36 psu salinity and 101 ?mol photons light - Ditylum brightwellii GSO105 (MMETSP1001)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016991 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212030 | Ga0186318 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with Sargasso seawater w/o nitrate, 14 C, 36 psu salinity and 101 ?mol photons light - Ditylum brightwellii GSO105 (MMETSP1001) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 28711313 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | Pacific Ocean |
| Coordinates | Lat. (o) | 47.74 | Long. (o) | -122.417 | Alt. (m) | N/A | Depth (m) | .5 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F081743 | Metagenome / Metatranscriptome | 114 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186318_110567 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii | 1061 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0186318_110567 | Ga0186318_1105672 | F081743 | MHSLDHALMDWNLEDPLWLDVDDPKYGKMAEIGRIIKVGFVPEVGGYYFHRKWKGSGHPFYEAVYRKLVKIDRKFADAMDTCICR |
