x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016910
3300016910: Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium, at 20 C, 30 psu salinity and 572 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0744)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016910 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211911 | Ga0186199 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium, at 20 C, 30 psu salinity and 572 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0744) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 26631944 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102 | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | |
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F045520 | Metagenome / Metatranscriptome | 152 | Y |
| F051162 | Metagenome / Metatranscriptome | 144 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186199_104972 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102 | 1829 | Open in IMG/M |
| Ga0186199_105398 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae | 1748 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0186199_104972 | Ga0186199_1049721 | F045520 | MAFNRLYKQIETLIRTDDEVADSIPCKSDILSLRECRKGGKTCDDLGLELLRCMAQYKVDTTEKIRQAIGVAKYNEYVKAMVEKHGKEKAEEIIAEPSEQLKDIEAYQVLHRVANNTHPKGAPKTAEGIKEWTYADQVRLEMGEQEWWDAVKIVGCEFGVEKADALFGLAKEKELIESAQDRLVPGLKEKRAQGLEAYKKVEASVKEAAPGAKSPADYAAAFKDLYPTKEDLESALK |
| Ga0186199_105398 | Ga0186199_1053981 | F051162 | KIFAKQTMKKPINLASLQSKMCNIWGTKPNTTKLMLCRVEDWTDESFQEDCYVDIRAYGKAERTREMVLDGMEKVQASFLDHGLVANVRLETYDGERYFHVPPKAPKS |
