NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016888

3300016888: Metatranscriptome of coastal eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, no nitrate, 14 C, 36 psu salinity and 154 ?mol photons light - Skeletonema menzellii CCMP 793 (MMETSP0604)



Overview

Basic Information
IMG/M Taxon OID3300016888 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212410 | Ga0186698
Sample NameMetatranscriptome of coastal eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, no nitrate, 14 C, 36 psu salinity and 154 ?mol photons light - Skeletonema menzellii CCMP 793 (MMETSP0604)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26072210
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)41.566Long. (o)-70.5842Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034938Metagenome / Metatranscriptome173Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186698_110733All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema896Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186698_110733Ga0186698_1107331F034938NTLVQWRGNVVSEKEAKALRHVVXXXXXQRPDPRVRFNIVNLAHPGQGHIWHGDVEFTYDIEGDHCNLKYTSMDVCVDLTPKLVHRHGQPMLQNYGKTWVYVYLPQPTIDRIKSYVKAGTGWDVSDEGFIEDPNRNVTAIEAKMNHRSEELPEPSFWAMKDKDASEGEEEIMSFSRIGSVQEVMAQSHQQHVHRGVGIFSVTMEVEGTPNFMPTPGEGDEAKLRFTLVSARTWGFTESVAPIVYAPSKWH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.