NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016874

3300016874: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in enriched f/2 medium with seawater, 10.6uM sodium metasilicate, 16 C, 35 psu salinity and 441 ?mol photons light - Pseudo-nitzschia fraudulenta WWA7 (MMETSP0853)



Overview

Basic Information
IMG/M Taxon OID3300016874 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212036 | Ga0186324
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in enriched f/2 medium with seawater, 10.6uM sodium metasilicate, 16 C, 35 psu salinity and 441 ?mol photons light - Pseudo-nitzschia fraudulenta WWA7 (MMETSP0853)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22748722
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecovesea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)34.0847Long. (o)-119.05Alt. (m)N/ADepth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015298Metagenome / Metatranscriptome255Y
F056296Metagenome / Metatranscriptome137Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186324_100138All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae4259Open in IMG/M
Ga0186324_108609All Organisms → cellular organisms → Eukaryota1101Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186324_100138Ga0186324_1001381F015298MTIGMLNSLVPHKDKLLLFCISVDAVNTIITFPMIMWNGPKWLLQSTDPNAKEKIEDADEGKEVVDLSDTDRRSFKVLWEIFGVCYEGYFGFTISTLICLFQSPETRPIFAYSLFALYVYKAKSFLTTFKTDNTQGKAKLLTILCFYFPCYGGYCLLHLAENYLL
Ga0186324_108609Ga0186324_1086091F056296NNTFFVESKKTTTTMKSIVAVLISLLAVSNAVELTLENFEEKTAGKTVFIKFLAPW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.