NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016862

3300016862: Metatranscriptome of marine eukaryotic communities from Arctic in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 12.5 C, 35 psu salinity and 476 ?mol photons light - micromonas sp. CCMP2099 (MMETSP1390)



Overview

Basic Information
IMG/M Taxon OID3300016862 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212302 | Ga0186590
Sample NameMetatranscriptome of marine eukaryotic communities from Arctic in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 12.5 C, 35 psu salinity and 476 ?mol photons light - micromonas sp. CCMP2099 (MMETSP1390)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size19593400
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationArctic
CoordinatesLat. (o)76.2833Long. (o)-74.75Alt. (m)N/ADepth (m)55
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030876Metagenome / Metatranscriptome184N
F056268Metagenome / Metatranscriptome137N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186590_108365Not Available762Open in IMG/M
Ga0186590_108998Not Available617Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186590_108365Ga0186590_1083651F056268LREIASRFGKGSCLVCFAIFGRFLGFGGKRFSRENVPEMTELEGFL
Ga0186590_108998Ga0186590_1089981F030876MEAIQREQHAAYMRDLRQSREYKDRENRMRVLGRIREGSVPHVYSLTKYITRDDINDLRRRNGFDDLTETIPYWAEATRLRRRNMEDPSSYVPEAPPAQPATDLPDRVGTAGDANKEAFSVKAINTHFRTEGREIGTKTNQRAKQGTISRQFGPLNSDEKSGRFARFMEFLGPRYLEDARELLGRNTLRRIETEMT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.