Sample 3300013969

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013969

3300013969: Marine microbial communities from various locations - University of British Columbia - seawater enrichment SCG69

Overview

Basic Information
IMG/M Taxon OID	3300013969 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118603 \| Gp0137425 \| Ga0120039
Sample Name	Marine microbial communities from various locations - University of British Columbia - seawater enrichment SCG69
Sequencing Status	Permanent Draft
Sequencing Center	University of British Columbia
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	491798
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092898	Metagenome / Metatranscriptome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0120039_10271	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120039_10271	Ga0120039_102711	F092898	MIEQFQEVEFETRTIGPLVLTAPVLQSPGFRGIVNCYCPIAEQADLDHGLVAELVTQVQNSHSQGFCSV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.