| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013957 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118583 | Gp0137234 | Ga0119892 |
| Sample Name | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - JXZ_EW_meta |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Nanjing University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 29003621 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Nanjing | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103024 | Metagenome / Metatranscriptome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119892_114413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119892_114413 | Ga0119892_1144131 | F103024 | ETKQMRTSRKLTHSLLALFALVVMSSFAMAADPGLLVPPTSEVSDQKAGSLLIYNVYTSGATSGNTENTRINITNTSVTSAAFVHLYFVSAGCGIADSYICLTATQTASFLASDVDPGIKGYIVGVAVDGVLGCPVAFNWLIGDEYVKFASGHAANLGALAFAALYDGRLPGCDANSVTA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |