Basic Information | |
---|---|
IMG/M Taxon OID | 3300013957 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118583 | Gp0137234 | Ga0119892 |
Sample Name | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - JXZ_EW_meta |
Sequencing Status | Permanent Draft |
Sequencing Center | Nanjing University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 29003621 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
Type | Engineered |
Taxonomy | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Nanjing | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103024 | Metagenome / Metatranscriptome | 101 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0119892_114413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0119892_114413 | Ga0119892_1144131 | F103024 | ETKQMRTSRKLTHSLLALFALVVMSSFAMAADPGLLVPPTSEVSDQKAGSLLIYNVYTSGATSGNTENTRINITNTSVTSAAFVHLYFVSAGCGIADSYICLTATQTASFLASDVDPGIKGYIVGVAVDGVLGCPVAFNWLIGDEYVKFASGHAANLGALAFAALYDGRLPGCDANSVTA |
⦗Top⦘ |