NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013057

3300013057: Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C Kraft MG (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300013057 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127392 | Gp0191753 | Ga0164272
Sample NameEnriched Miracle-Growth compost microbial communities from Emeryville, California, USA - RNA 3rd pass 37_C Kraft MG (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size37514324
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeanthropogenic environmentcompost
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012224Metagenome / Metatranscriptome282N
F094455Metagenome / Metatranscriptome106Y
F102635Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0164272_115790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1367Open in IMG/M
Ga0164272_135166Not Available502Open in IMG/M
Ga0164272_148999Not Available968Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0164272_115790Ga0164272_1157901F102635TLFGDDEELMRAKADCVYHILRQIVEGIPTVQITTRLPENLSEEQLAILTESNRQAALKGIEVAMTHSVQVLMSSIYDLCTSKLKDARY*
Ga0164272_135166Ga0164272_1351662F094455MYNVTEFPIDRLSDRELRIREWEVVMSGGYGSSEHKRLQSEIRRRTVNLYAAAQPYTTH*
Ga0164272_148999Ga0164272_1489991F012224MITQESTMIQVKCVGGECNGITVRVEPQPTYYEVIDPRDPARRDYYILEVGQWGARLVPEST

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.