Basic Information | |
---|---|
IMG/M Taxon OID | 3300012796 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0191493 | Ga0160498 |
Sample Name | Enriched soil microbial communities from UW Madison campus, WI, USA - DID2878_E24_Xylan MG |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 48127918 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → university campus → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Madison, Wisconsin | |||||||
Coordinates | Lat. (o) | 43.073 | Long. (o) | -89.4011 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081732 | Metagenome / Metatranscriptome | 114 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0160498_102473 | Not Available | 1604 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0160498_102473 | Ga0160498_1024733 | F081732 | LSLTLRAGEKIHIGGLVLNILKKLKGLRLMCPSVSMVEAKQMGLGAMAYCR* |
⦗Top⦘ |