Sample 3300012796

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300012796

3300012796: Enriched soil microbial communities from UW Madison campus, WI, USA - DID2878_E24_Xylan MG

Overview

Basic Information
IMG/M Taxon OID	3300012796 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121620 \| Gp0191493 \| Ga0160498
Sample Name	Enriched soil microbial communities from UW Madison campus, WI, USA - DID2878_E24_Xylan MG
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	48127918
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → university campus → soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	USA: Madison, Wisconsin
Coordinates	Lat. (^o)	43.073	Long. (^o)	-89.4011	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081732	Metagenome / Metatranscriptome	114	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0160498_102473	Not Available	1604	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0160498_102473	Ga0160498_1024733	F081732	LSLTLRAGEKIHIGGLVLNILKKLKGLRLMCPSVSMVEAKQMGLGAMAYCR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.