NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011975

3300011975: Seawater microbial communities from Norwegian Young Sea Ice, Arctic Ocean, Norway, 2015. Combined Assembly of 9 SPs correct ver.



Overview

Basic Information
IMG/M Taxon OID3300011975 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121717 | Gp0173404 | Ga0156901
Sample NameSeawater microbial communities from Norwegian Young Sea Ice, Arctic Ocean, Norway, 2015. Combined Assembly of 9 SPs correct ver.
Sequencing StatusPermanent Draft
Sequencing CenterLGC Genomics
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size11493767
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameNorwegian Young Sea Ice 2015 - N-Ice15
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Norwegian Young Sea Ice 2015 - N-Ice15

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationArctic Ocean
CoordinatesLat. (o)83.166667Long. (o)22.016944Alt. (m)N/ADepth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021649Metagenome / Metatranscriptome218Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0156901_1096516All Organisms → Viruses → Predicted Viral3122Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0156901_1096516Ga0156901_10965166F021649XXXXGVFYDLMTTEEIDFGIHELFPTDCVHSFLGWAKNAEGTDVEPDELITE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.