NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011871

3300011871: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00705



Overview

Basic Information
IMG/M Taxon OID3300011871 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118444 | Gp0135253 | Ga0121021
Sample NameUrban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00705
Sequencing StatusPermanent Draft
Sequencing CenterWeill Cornell Medical College
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size48428460
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUrban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
TypeEngineered
TaxonomyEngineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA:New York City
CoordinatesLat. (o)40.86Long. (o)-73.91Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009686Metagenome / Metatranscriptome314Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0121021_100047Not Available111190Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0121021_100047Ga0121021_10004729F009686MSEREMFEQSFKRPSNYFKLTSREQWNIDAELGILDWQGDDLSNEDMKRFNEHYN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.