NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011364

3300011364: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung Idec1 Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300011364 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116274 | Gp0153828 | Ga0151148
Sample NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung Idec1 Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size43853289
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Vannellidae → Vannella → Vannella robusta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Point Reyes National Seashore, California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000358Metagenome / Metatranscriptome1237Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0151148_184466All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Vannellidae → Vannella → Vannella robusta570Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0151148_184466Ga0151148_1844661F000358RKMGGTNTKGLYLCEQIYPPENGASCIPPEKLEKAIQKGLIPRPVANDDDLDDDMDSKIDAGIKDVWAYYDKKNKGFLTKGEAETFFKDALEIMALRKGRKVKEILPPNVSQSQAISQSIAKLSKGAQQVDFAAFEEFVNMSDLDEAMSLFTGQTGPVDVKTNIELLDTSKLAAEAKASKNQPVYRDYPD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.