NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011278

3300011278: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP199 (Metagenome Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300011278 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0092414 | Ga0138353
Sample NameMetatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP199 (Metagenome Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17641608
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth of Cape Verde, Atlantic Ocean
CoordinatesLat. (o)7.32Long. (o)-26.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003009Metagenome / Metatranscriptome513Y
F044934Metagenome / Metatranscriptome153Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0138353_114431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora2007Open in IMG/M
Ga0138353_121700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1199Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0138353_114431Ga0138353_1144312F044934VFAGLSSTVSFTNLLITRRTLSMPGMRHRRVLLPFVTIGTLFALRMLAIITPVLGAAMIMMMLDRH*
Ga0138353_121700Ga0138353_1217002F003009GSYYNLGIRSIYHYFAVLAVSFHDIHSLFGFFTFLTVASQLVSGTMLAFSLVPEPMIVPIVRNEEDMEDLYTDDFF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.