| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300011111 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121704 | Gp0173492 | Ga0151501 |
| Sample Name | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Toyama Prefectural University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 98440549 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → unclassified Ignavibacteriota → Ignavibacteriae bacterium HGW-Ignavibacteriae-4 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Dna From Seawater And Marine Sediment |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Environmental Dna From Seawater And Marine Sediment |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Japan Sea near Toyama Prefecture, JAPAN | |||||||
| Coordinates | Lat. (o) | 37.035 | Long. (o) | 137.41472 | Alt. (m) | N/A | Depth (m) | 803 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000352 | Metagenome / Metatranscriptome | 1247 | Y |
| F015879 | Metagenome | 251 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0151501_1018004 | Not Available | 712 | Open in IMG/M |
| Ga0151501_1054896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → unclassified Ignavibacteriota → Ignavibacteriae bacterium HGW-Ignavibacteriae-4 | 697 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0151501_1018004 | Ga0151501_10180043 | F000352 | MKTIKLTEGDAIFVHYVLRMYANQTAGLDSEDKVEI* |
| Ga0151501_1054896 | Ga0151501_10548961 | F015879 | DVIIISCNVCGAMSHAIKTKILKGYYVKDEFVVCKICFGELK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |