NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010409

3300010409: Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA ? sample B



Overview

Basic Information
IMG/M Taxon OID3300010409 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121514 | Gp0155293 | Ga0136855
Sample NameGiant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA ? sample B
Sequencing StatusPermanent Draft
Sequencing CenterLeibniz Institute
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size189059224
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGiant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated → Giant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationMonterey Bay, California, USA
CoordinatesLat. (o)36.619Long. (o)-121.9Alt. (m)N/ADepth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077438Metagenome / Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136855_166751All Organisms → cellular organisms → Bacteria1172Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136855_166751Ga0136855_1667512F077438STHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.