NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010206

3300010206: Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCP16c



Overview

Basic Information
IMG/M Taxon OID3300010206 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0120452 | Gp0154473 | Ga0136454
Sample NameLittoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCP16c
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size69275633
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhototrophic Microbial Communities
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → freshwater littoral zone → lake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationLake Waban, Wellesley MA
CoordinatesLat. (o)42.2876Long. (o)-71.30117Alt. (m)N/ADepth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069690Metagenome123Y
F087946Metagenome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136454_100090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes666882Open in IMG/M
Ga0136454_100490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes94371Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136454_100090Ga0136454_100090309F087946MLSKERLPDIIVIALLLLILLAMNYFKIIHVIGNYPFVFLLIMYFIGRAVTWYVISKHMDKDE*
Ga0136454_100490Ga0136454_10049074F069690MTNPEIINRTFRFIYNIPSNFIEEIWSDSPLLADHLKAKFIGFCKSEGYASANAILKFFASLDESNTEKFCFYASSWIQEHN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.