| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010057 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120351 | Gp0146716 | Ga0126365 |
| Sample Name | Continental margin sediment microbial communities from China - WA_23_40 metaT (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 472563 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Continental Margin Sediment Microbial Communities From Various Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → continental margin → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Qiqihar, Heilongjiang | |||||||
| Coordinates | Lat. (o) | 47.5233 | Long. (o) | 125.0078 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013050 | Metagenome / Metatranscriptome | 275 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0126365_10878 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 2004 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0126365_10878 | Ga0126365_108781 | F013050 | MSKGKQPRTRVKVPKLLLSEIKDVFFKNNQEIGLEAAIF* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |