NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010057

3300010057: Continental margin sediment microbial communities from China - WA_23_40 metaT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300010057 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120351 | Gp0146716 | Ga0126365
Sample NameContinental margin sediment microbial communities from China - WA_23_40 metaT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size472563
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameContinental Margin Sediment Microbial Communities From Various Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecontinental marginmarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationChina: Qiqihar, Heilongjiang
CoordinatesLat. (o)47.5233Long. (o)125.0078Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013050Metagenome / Metatranscriptome275Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0126365_10878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata2004Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0126365_10878Ga0126365_108781F013050MSKGKQPRTRVKVPKLLLSEIKDVFFKNNQEIGLEAAIF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.