Sample 3300010005

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300010005

3300010005: Microbial communities associated with xenic strain Fischerella muscicola UTEX 1829

Overview

Basic Information
IMG/M Taxon OID	3300010005 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118857 \| Gp0141690 \| Ga0120997
Sample Name	Microbial communities associated with xenic strain Fischerella muscicola UTEX 1829
Sequencing Status	Permanent Draft
Sequencing Center	Oregon State University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	125595532
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities Associated With Xenic Strain Fischerella Muscicola Utex 1829
Type	Environmental
Taxonomy	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Microbial Communities Associated With Xenic Strain Fischerella Muscicola Utex 1829

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant corpus

Location Information
Location	UTEX collection
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102772	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0120997_100802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	21025	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120997_100802	Ga0120997_1008023	F102772	MSNDASRLRAILSAASVYLFFEAGLAAQTVDELPDPQEPMLAEPGDWAADFNEAQSACYQGSMRACDSIWLSERVLLDSFLDHYGRTCGGRVDLREIRRANLNCTEAFPGHD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.