x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300009916
3300009916: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, 12m depth; RNA IDBA-UD
Overview
Basic Information |
IMG/M Taxon OID | 3300009916 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116874 | Gp0151163 | Ga0132235 |
Sample Name | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, 12m depth; RNA IDBA-UD |
Sequencing Status | Permanent Draft |
Sequencing Center | Marine Biological Laboratory |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 14271346 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1 | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
Location Information |
Location | Falmouth, Massachusetts |
Coordinates | Lat. (o) | 41.548517 | Long. (o) | -70.622961 | Alt. (m) | N/A | Depth (m) | 12 |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F082866 | Metagenome / Metatranscriptome | 113 | Y |
F088317 | Metagenome / Metatranscriptome | 109 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0132235_100268 | All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1 | 1385 | Open in IMG/M |
Ga0132235_101692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 773 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0132235_100268 | Ga0132235_1002682 | F082866 | MHHQLPNRKRSLSLLLRKASGSGKICVLSQIEPQTPRLVVSLRQYLQVSDLHPYFPQSLKPFGFLGAVSTCAHCLDGSV* |
Ga0132235_101692 | Ga0132235_1016921 | F088317 | MPGPEDNVKYPEPQKFTQEELCKDAPKTRRDLWYGNSYTPTLPPLDESQLVRWIKSGGKEEEVAGRYVMMPPPELPFRKLPVSTKFISCNTRHLKEIGAFRTMLPELFGDAGYKAVDDAYASFAYSEFKTAQKRGQLLNAPNCTAREIGTFIATVYDIQNFPIVIAEASDERVRIQLYKGLPIYCPYDVRRGDYRLCAATAAYERELVKLCNPKLHAYLSRTKAIGDDCCELTI |