NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009916

3300009916: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, 12m depth; RNA IDBA-UD



Overview

Basic Information
IMG/M Taxon OID3300009916 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116874 | Gp0151163 | Ga0132235
Sample NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, 12m depth; RNA IDBA-UD
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size14271346
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomemeromictic pondpond water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)N/ADepth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082866Metagenome / Metatranscriptome113Y
F088317Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0132235_100268All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11385Open in IMG/M
Ga0132235_101692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium773Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0132235_100268Ga0132235_1002682F082866MHHQLPNRKRSLSLLLRKASGSGKICVLSQIEPQTPRLVVSLRQYLQVSDLHPYFPQSLKPFGFLGAVSTCAHCLDGSV*
Ga0132235_101692Ga0132235_1016921F088317MPGPEDNVKYPEPQKFTQEELCKDAPKTRRDLWYGNSYTPTLPPLDESQLVRWIKSGGKEEEVAGRYVMMPPPELPFRKLPVSTKFISCNTRHLKEIGAFRTMLPELFGDAGYKAVDDAYASFAYSEFKTAQKRGQLLNAPNCTAREIGTFIATVYDIQNFPIVIAEASDERVRIQLYKGLPIYCPYDVRRGDYRLCAATAAYERELVKLCNPKLHAYLSRTKAIGDDCCELTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.