NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009834

3300009834: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 2, 6m depth; RNA IDBA-UD



Overview

Basic Information
IMG/M Taxon OID3300009834 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0116874 | Gp0149179 | Ga0131969
Sample NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 2, 6m depth; RNA IDBA-UD
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10411857
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → meromictic pond → pond water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSiders Pond, Falmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)N/ADepth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000237Metagenome / Metatranscriptome1498Y
F000344Metagenome / Metatranscriptome1257Y
F005089Metagenome / Metatranscriptome412Y
F036207Metagenome / Metatranscriptome170Y
F073632Metagenome / Metatranscriptome120N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0131969_101647Not Available830Open in IMG/M
Ga0131969_104029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae584Open in IMG/M
Ga0131969_104670Not Available548Open in IMG/M
Ga0131969_105275Not Available521Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0131969_101647Ga0131969_1016471F000344MRPKSAHAALSGVGEHPARESESAKWSAAGKERVANPNPNPNPNPN
Ga0131969_103403Ga0131969_1034031F000237LHVMFCHES*DSDSGENVYEDKSGTYVS*FYDAFLKEIQDA*Y*TLYVFVYFIIHHFDASTVNYFFFER*NISELDEIRFYGVAPH*YFRPLMGLLVVSPSHYEGLM*MALWFVLLASLPIIYNFYNSSKYYLPIIPMQSSMSQTLCFILFMLSMYCTASMLPCGRYYYAPEGGYVGNP*VKFSYQYAYLYMA*ILHHLDIIEH*GFR
Ga0131969_104029Ga0131969_1040291F073632EQSYGFMYGVPMNFKTLYKVGASDKAVWRFQVGNMQFGRNYYEPSQQRSSWMSVGGSIGREWRKEMNADLRFFHGPLIGAEMSMSRSVSDVPPGTDNSYFYIMPNVIYVLGIQYRINPALYVAAEIHPGINTQFNYNDGNWSPNRYMSGGMNGQLALLSVAYQFETYKKGKTRKARGIVQTPE*
Ga0131969_104670Ga0131969_1046701F036207VINFISGTVFGIIVATIGFSSVATTLDKVMFNLQKTTVELNRPQLP
Ga0131969_105275Ga0131969_1052751F005089LTEKLALENYNARNGVVDYRLDGVCNHYFPKYEGMNPSYRNGEICLSCRVAKTVKGQLRYTFRIDGKRIAEKMIVSEFLALGAFQG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.