Sample 3300008927

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008927

3300008927: Microbial communities from freshwater in the western basin of Lake Erie, USA - 973-3

Overview

Basic Information
IMG/M Taxon OID	3300008927 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117964 \| Gp0126294 \| Ga0103705
Sample Name	Microbial communities from freshwater in the western basin of Lake Erie, USA - 973-3
Sequencing Status	Permanent Draft
Sequencing Center	University of Tennessee
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	6544488
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → freshwater lake → lake water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	western basin of Lake Erie, USA
Coordinates	Lat. (^o)	41.79	Long. (^o)	-83.33	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060948	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103705_102052	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata	783	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103705_102052	Ga0103705_1020521	F060948	FAFLIIQLTVFLGLVLCCTHLSDVTLTIAKNAFRTFFLFIGKVEWLLFTDGMLNSDTVIRLAYAHYVVAFYLFFLGLSHGIDMHYD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.