NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008764

3300008764: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2065



Overview

Basic Information
IMG/M Taxon OID3300008764 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117986 | Gp0126502 | Ga0103913
Sample NameMicrobial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2065
Sequencing StatusPermanent Draft
Sequencing CenterMassachusetts Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size8852690
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysurface water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001293Metagenome / Metatranscriptome729Y
F027191Metagenome / Metatranscriptome195Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103913_100337All Organisms → cellular organisms → Eukaryota → Sar793Open in IMG/M
Ga0103913_101319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae530Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103913_100337Ga0103913_1003371F027191MRERKERKKNEREKPLLQSINLVKVVRFLISPKKKRAKIEVNKIMNPAFLLGTAFNIAYWHRKYHSGTICKGVSNAQASNALSGCEREEIPK*
Ga0103913_101319Ga0103913_1013191F001293MIRNSLICKLINVQASMKENNEKKINNEHEISKLTKAPPKDTAALDKRSVLAKVNSQGSGT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.