NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008691

3300008691: Planktonic microbial communities from coastal waters of California, USA - Canon-52



Overview

Basic Information
IMG/M Taxon OID3300008691 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117987 | Gp0126533 | Ga0103944
Sample NamePlanktonic microbial communities from coastal waters of California, USA - Canon-52
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Hawaii
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2192654
Sequencing Scaffolds4
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED1971
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePlanktonic Microbial Communities From Coastal Waters Of California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → coastal water body → coastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000123Metagenome / Metatranscriptome2053Y
F003081Metagenome / Metatranscriptome508Y
F004235Metagenome / Metatranscriptome447Y
F048633Metagenome / Metatranscriptome148N
F084730Metagenome / Metatranscriptome112Y
F099434Metagenome / Metatranscriptome103Y
F100952Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103944_10625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197734Open in IMG/M
Ga0103944_10727Not Available706Open in IMG/M
Ga0103944_11312All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
Ga0103944_11816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103944_10625Ga0103944_106251F048633MDINIGDNNMPMKKAMPGGKIVNKGKYKHGGKVHRNKKGHGGVMTIVLKKDKTKKK*
Ga0103944_10727Ga0103944_107271F004235MPIAPNRTVTALIGEQDFIGKAITMIAVDWDVDADASREAMEAVSNTILSRATILAAGAVYDTGTKQDFLLEGDFTSTINDFTSLDGTVTGTLAQVLVEDIINLGTVDSINFGSGTVACTIKTTFKYA*
Ga0103944_10727Ga0103944_107272F099434MPATKNNFSHVTNMELEGVATSTSVVDFINAMTAETGDLSTGSATAGLEATRAVISSYINILSEGPLHESDKQKTY
Ga0103944_11312Ga0103944_113123F084730AVGYFSYLNRIASGVYLYDPSNCIYGYGTPKRALIFFK*
Ga0103944_11781Ga0103944_117811F100952HGRHRGAKQNQRVNPLADNYTGQQISSRFVQPGVMVLNKENTQFMLPWIEKYKDIKDDRIDDGMFLNSCIVDSDVPLLDMDKKFNHKNNGEQFDYNNVYFLHCAGGKKHKRQVKIWDKLKKIYPEVNPDLSGLIQ*
Ga0103944_11816Ga0103944_118161F003081GLVVELREEMFNDTRFGAEVFYMHVRGVDTLMVLSYLHIFKKLYLKNYVTSESDG*
Ga0103944_12225Ga0103944_122251F000123TIVDSISIMAVLAVLALAVTAQGAMLRAAQEPDTACGKGFDNLVGGSQEYYKTASKELWNHPYHLTDAATFEKEFQCWFANMATTKCGGLPSQADARKDKLTEMCKAHNTEWYPIWKMFSDEEVKWFKDSYPALPTEGDVRTVSVGANEARGEADISYKQAMNTVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.