NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008653

3300008653: Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Powermax_1b



Overview

Basic Information
IMG/M Taxon OID3300008653 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117956 | Gp0126231 | Ga0103642
Sample NameMicrobial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Powermax_1b
Sequencing StatusPermanent Draft
Sequencing CenterAuburn University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6426686
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomerhizospheresoil
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationOhio, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010686Metagenome / Metatranscriptome300Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103642_100448Not Available517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103642_100448Ga0103642_1004482F010686MGDYGQVTKGIRGMSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.