| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008584 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117956 | Gp0126244 | Ga0103655 |
| Sample Name | Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_2a |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Auburn University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 7048057 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → rhizosphere → soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Ohio, USA | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001679 | Metagenome / Metatranscriptome | 653 | Y |
| F010686 | Metagenome / Metatranscriptome | 300 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103655_100211 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| Ga0103655_100987 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | 536 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103655_100211 | Ga0103655_1002112 | F001679 | VWRMSRRQEAMKGVEGCEKPGVAVKQALIPGFPNYHVLNP* |
| Ga0103655_100987 | Ga0103655_1009871 | F010686 | AVVSTQSTWGGQATKGVWGMPRRQEAKKGVEDCDKPGGLVKRELIPGFPNHPIVNP* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |