| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008570 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117973 | Gp0126367 | Ga0103778 |
| Sample Name | Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-MB-F-D |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Centre National de la Recherche Scientifique (CNRS) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 14919608 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → cellular organisms → Eukaryota | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Champs-sur-Marne, France | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015858 | Metagenome / Metatranscriptome | 251 | Y |
| F034926 | Metagenome / Metatranscriptome | 173 | N |
| F100333 | Metagenome / Metatranscriptome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103778_101191 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| Ga0103778_104831 | All Organisms → cellular organisms → Eukaryota | 533 | Open in IMG/M |
| Ga0103778_105275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103778_101191 | Ga0103778_1011912 | F015858 | VSNLIGWGIVYCSTWFGQADETTLSIQNESAPPCFAPANDIATPFLERVEADGGTFEGYDCLVAALQDLGEDTYYDIFDTYIQRMTDDGATLEGEECLIDQLFILN* |
| Ga0103778_104831 | Ga0103778_1048311 | F100333 | QIGKMVYFTYKKLNICTVALLATVFAVLIAAMAVDWYSYKVEFSYTRVAASDSSLASSLYNYTQTNFDMFGQTVNTQGANTKIVRTVQQTYAQLGASNVNEQFKIQQAFVLIALLAAGLLFVAHTLYFFDGFRNKILFFVGITALRTILVIALLVVVASEIIAFLAFLGLSDKIASD |
| Ga0103778_105275 | Ga0103778_1052751 | F034926 | MGYIEVYNIDKDGEWTDLDDIPMITVINCQLCNEPTEAHDIIIPAVIKDGVLTAGTWQCRKCKTVNG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |