NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008563

3300008563: Planktonic microbial communities from coastal waters of California, USA - Canon-42



Overview

Basic Information
IMG/M Taxon OID3300008563 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117987 | Gp0126525 | Ga0103936
Sample NamePlanktonic microbial communities from coastal waters of California, USA - Canon-42
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Hawaii
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2423443
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePlanktonic Microbial Communities From Coastal Waters Of California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002495Metagenome / Metatranscriptome554Y
F003081Metagenome / Metatranscriptome508Y
F026579Metagenome / Metatranscriptome197N
F097458Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103936_10826Not Available717Open in IMG/M
Ga0103936_10887Not Available704Open in IMG/M
Ga0103936_11231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea633Open in IMG/M
Ga0103936_12249All Organisms → cellular organisms → Bacteria516Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103936_10826Ga0103936_108263F026579PRQDMKMNLIVLMLAIIAISVSQPSFSKTVSEVKIIFADEEGEGSPTDEEPDCE*
Ga0103936_10887Ga0103936_108871F097458YKLPPIFLSFTFAALLPRRGIYALADIQKIFIQNIIPIDSRYGLLGSPILLDNLVIPLILLISF*
Ga0103936_11231Ga0103936_112311F003081MFNDTRFGAEVFYMHLRGVDTVFFFTYLHILKKIYLKNYVTAESDG*
Ga0103936_12249Ga0103936_122492F002495SDNGSGKQKDWVLFPYDANNEKAIRIDFSGNVNLDNGNKGTILGVKGASKNGNTKFVKVFAQVGVLFKGDDKFTGEMNYAEAGGHKGLIGWINESGNILSGYKNEPRPKQAKPQSKEIPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.