NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006710

3300006710: Metatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL120807 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006710 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053074 | Gp0092411 | Ga0031677
Sample NameMetatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL120807 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size90291086
Sequencing Scaffolds10
Novel Protein Genes12
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
Not Available2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → alpha proteobacterium HIMB591

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBlanes Bay
CoordinatesLat. (o)41.67Long. (o)2.8Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000075Metagenome / Metatranscriptome2622Y
F001583Metagenome / Metatranscriptome668Y
F024568Metatranscriptome205Y
F035314Metagenome / Metatranscriptome172N
F037503Metagenome / Metatranscriptome168Y
F056627Metagenome / Metatranscriptome137N
F058929Metagenome / Metatranscriptome134N
F070259Metagenome / Metatranscriptome123Y
F103188Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0031677_1012987All Organisms → cellular organisms → Bacteria1915Open in IMG/M
Ga0031677_1014275All Organisms → cellular organisms → Bacteria1796Open in IMG/M
Ga0031677_1015814All Organisms → cellular organisms → Eukaryota1707Open in IMG/M
Ga0031677_1156768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea774Open in IMG/M
Ga0031677_1158090All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium500Open in IMG/M
Ga0031677_1188717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria725Open in IMG/M
Ga0031677_1197773Not Available561Open in IMG/M
Ga0031677_1201070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata605Open in IMG/M
Ga0031677_1217943Not Available774Open in IMG/M
Ga0031677_1220300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → alpha proteobacterium HIMB59543Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0031677_1000611Ga0031677_10006111F000075DLLVSLESTLSSAQASEARGDADAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK*
Ga0031677_1001917Ga0031677_10019171F000075FAIAVAANKYDSMNEDDLLVSLESTLSSAQASEARGDADAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK*
Ga0031677_1012987Ga0031677_10129872F037503MHLGAASRLSFIEVELLIGLGGFTAYQPLTNSECYEIYSGVRAWVLRSMSERERTQTIS*
Ga0031677_1014275Ga0031677_10142752F037503MHLGAASELSVIEVELLIRLGGFTAYQTLINSECYDICPGVRAWVLRSMSERERTQTIR*
Ga0031677_1015814Ga0031677_10158144F070259MKSESLVIVNQYVTVNDVSNFAHTAHHARRVVSAG
Ga0031677_1156768Ga0031677_11567681F001583EMFNDTRFGSEVFYMHVRGVDSLMLLSYIHILKKIFLKNYVTSESDG*LLGGYAFLFFHYIIFLGISLSATHLSDLTLTIGANIF*SLFNNFYKTYYIVFTNKHLNTDQLTRIMVLHYFTP*YYIYLIKLHVLFCHES*DSDSGENTYEDKTGTYVS*FYDAFLKEIQDA*Y*VTYVYLYFFLHHFNGSTINYFFFER*NIAELDEIRFYGVAPH*YFRPYMGLLVISPTHYEGLM*MGLFLGSLAFLPVIYNVYNAM
Ga0031677_1158090Ga0031677_11580901F024568RLTATFLASVAGLSDETSLMQGLKPQQVTQKEDKSKAIANLLQSATSMLKNGATPDVVDFAQETLTEITGVVLPAITDAHNADQQLVDSTFALFESEVFTQLRQGQARVDALAAEERRLSAAHIACRAQEEIDCINKRRCDYDLWELWRRFVEEEEILRQLSLQIN
Ga0031677_1188717Ga0031677_11887171F035314MIPPNIDNKRSSNVIDTKENFIANKKAMTLTTILKKEAENEEERAEYLRVMRFVKAIQKAPIKTKNIPDKETSLEPNGSAEINTPVKPRIMADILMILMFSFRKKWDITKSIKGELKRTG
Ga0031677_1197773Ga0031677_11977732F058929VKKIEIVTIYSVFLLDSLSTTSNISVAEHKVGVTADT
Ga0031677_1201070Ga0031677_12010701F001583SYYIIFTNKHLNVDQLTRFMILHYFTP*YYLYLIQMHVLFCHES*DSDSGETTYEDKTGTYAS*FYDGMLKEVQDG*Y*VMYIFIYFSLHHFNGASVNYFFFER*NIAEVDEIRYYGVAPH*YFRPLMGMLIVCPTHYEGVF*LLFYLGLLAMLPIVYNFYNSHTKHVPAIPMQNSLLQTTAFMLFMMSLYCTASILPCGR
Ga0031677_1217943Ga0031677_12179432F056627MAKTQIVEQAIAQIEETSTKRQIEAAKLLTNAVSGDLRAKTMLQEGISSSDIPTVLEPAINVIFLAQYAAEQNVWDQIADEYQAPNFGVIRFGDFQVDPSALVAGEGEEFINGGLPRVGEYEEYPAVPFTTTQLDKDFEGKYGVRARMSWESLRRTGDFDMIPRMTEKFAQYAARQEDFELAKLFVTSAGAVGSGFSGKGL
Ga0031677_1220300Ga0031677_12203002F103188HTMINKIRLNILKGAKPESFRFSSLNTQKITFAGFNKPRNQSKRIAA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.