NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006670

3300006670: T14 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006670 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117429 | Gp0125108 | Ga0101737
Sample NameT14 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size65461916
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon1
Not Available5
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048390Metagenome / Metatranscriptome148Y
F054136Metagenome140Y
F064732Metagenome / Metatranscriptome128Y
F064746Metagenome / Metatranscriptome128N
F080090Metagenome / Metatranscriptome115Y
F102132Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101737_107175All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon1597Open in IMG/M
Ga0101737_114441Not Available1002Open in IMG/M
Ga0101737_115274All Organisms → cellular organisms → Archaea962Open in IMG/M
Ga0101737_117820Not Available864Open in IMG/M
Ga0101737_121058Not Available769Open in IMG/M
Ga0101737_122712All Organisms → cellular organisms → Bacteria729Open in IMG/M
Ga0101737_122794Not Available727Open in IMG/M
Ga0101737_129354All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.606Open in IMG/M
Ga0101737_135732Not Available523Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101737_107175Ga0101737_1071751F054136VYIFSGAAFLWHGLKDATKDIDICCSYEDADRIVSALRMFANMESVTGINDVHFLRIIFKSFGLQIFIKGIWMGDEYQLLEAAPCDSLTFDGVTFLIPNVKTLIMIRDRQIQALYKEWKKLKGEKCT*
Ga0101737_114441Ga0101737_1144412F048390MVRFVRTLQHRVTPKGRDFYALSIPPQVAEALNLKAGGAVSICVNPVKKGTFEVTIKAVSDELS*
Ga0101737_115274Ga0101737_1152742F064732MEAAAEAAVAAAPEKCTMPPAQSAERNVKFPSSPMDPGPYIAAIATRSTSQQDPVPPGH
Ga0101737_117820Ga0101737_1178202F064732MEDTEAEAEAASTEARERCMMPPAQSAERHVRFPSSPMDPGRFIAAIVTRSTSPPGRPEDTDQIDALSDLFLSEYHLMGI*
Ga0101737_121058Ga0101737_1210581F054136MIENKAQLLADLAYVGSKVQAKNNVYIFAGAAFMWHGLKDATKDIDICCSYEEADRIVSELRMFGNMESVTGINDVHFLRIIFKSFSLQIFIKGIWMGDEYPLLEAAHSDSLSFGGITFLIPDVKTLIMIRDRQIQALYNEWKKLQGEKCV*
Ga0101737_122712Ga0101737_1227122F102132METQKVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDREKEKEIDPMEDGDPTYYKRLEANNKDRRGIIR*
Ga0101737_122794Ga0101737_1227941F064732AARERCTMPPAQSAERHVKFPSSPMAPGQCTAAIATRSTSLPGRPEDTDHLMGLKSDRVSQ*
Ga0101737_129354Ga0101737_1293541F064746LYAVMACGCLDTAQFKKSVTIDGHTFTAVLDDSWTNTSGEVATYVPTNLENQYGIPTGAYDWTGFEDYDAFSYRSGEPSGSVTKYGWAHIFVLKPKKDLAGSSSTDILKHAAYLTINPQNHRNAVLGDDLTEKEIEYNGKEAYLVEVEGELITPANGDDFINDNSYGAIAFFLDDDTAALIDVETTNNFRMSSKEVIDSIT
Ga0101737_135732Ga0101737_1357321F080090MPSPCDVLETEEHWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.