NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006314

3300006314: Prairie soil microbial communities from Kansas, USA, after rainfall - K01



Overview

Basic Information
IMG/M Taxon OID3300006314 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114560 | Gp0113159 | Ga0099587
Sample NamePrairie soil microbial communities from Kansas, USA, after rainfall - K01
Sequencing StatusPermanent Draft
Sequencing CenterOregon State University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size98162157
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePrairie Soil Microbial Communities From Kansas, Usa, After Rainfall
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeprairiebulk soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationKonza Prairie, Kansas, USA
CoordinatesLat. (o)39.1038Long. (o)-96.6133Alt. (m)N/ADepth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026344Metagenome / Metatranscriptome198N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0099587_10147193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0099587_10147193Ga0099587_101471931F026344IIGQRVVKLLMATTTKAKFLVSLATTPDHSSHRLTFDGRGVYSGFSLACFLPPRTVMIDLHPTAVGQHARLLYAACKAMPNVVERRDFRWDR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.