Sample 3300006314

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300006314

3300006314: Prairie soil microbial communities from Kansas, USA, after rainfall - K01

Overview

Basic Information
IMG/M Taxon OID	3300006314 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114560 \| Gp0113159 \| Ga0099587
Sample Name	Prairie soil microbial communities from Kansas, USA, after rainfall - K01
Sequencing Status	Permanent Draft
Sequencing Center	Oregon State University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	98162157
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → prairie → bulk soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Konza Prairie, Kansas, USA
Coordinates	Lat. (^o)	39.1038	Long. (^o)	-96.6133	Alt. (m)	N/A	Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026344	Metagenome / Metatranscriptome	198	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0099587_10147193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	552	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0099587_10147193	Ga0099587_101471931	F026344	IIGQRVVKLLMATTTKAKFLVSLATTPDHSSHRLTFDGRGVYSGFSLACFLPPRTVMIDLHPTAVGQHARLLYAACKAMPNVVERRDFRWDR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.