NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006228

3300006228: Marine sediment microbial communities, 0.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC139



Overview

Basic Information
IMG/M Taxon OID3300006228 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116840 | Gp0121732 | Ga0082388
Sample NameMarine sediment microbial communities, 0.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC139
Sequencing StatusPermanent Draft
Sequencing CenterYale Center for Genome Analysis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26796652
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biomemarine benthic featuremarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)28.3Long. (o)-88.2Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061006Metagenome / Metatranscriptome132Y
F082866Metagenome / Metatranscriptome113Y
F082867Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0082388_120390Not Available751Open in IMG/M
Ga0082388_123765All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11528Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0082388_120372Ga0082388_1203721F061006GAEPFHQMDSIPIDRRTPEQKAKDVDDILNWQRNPRDHEGPETEPFRKIDQMLPQKAGQSPKARANDIDNTLTWLRNRGIEEPCDEDSPFQKVKSIPMPDSRSPQQKAKDVEDALNWVRNPKDSESSPETADFAKIDQLLPKKPGQKPQDRAKDLDNALSWVRNRGVDEPEFGGAEPFHQMDSIPIDRRTPEQKAKDVDDILNWQRNPHDHEGPETEPFKKIDQILPGKAGQTPEARANDIDNTLTWLRN
Ga0082388_120390Ga0082388_1203901F082867MTGGRKKGSRSRRVHHINDINHNDTNITVQYRVVKPLTFSSNTLVLSVNPSLTDLSTTLATIYRQYRVTELSFTFQCSDAAGAYALAMQYVPQIGGTPSTLPTTLAEFEGPAVGYCETGRGREYTYRVPSHVLNAMGLNYYATRTGVTPIQDPDILTQGLMIFLTSTPATPIVAYMHVKFEFQTLEDPSFLAKLMHDDEEADTLVVPRAKADSLKSMTWNQL*
Ga0082388_123765Ga0082388_1237653F082866MHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPRNAS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.