NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006084

3300006084: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTD1200_DNA



Overview

Basic Information
IMG/M Taxon OID3300006084 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111355 | Gp0121531 | Ga0081982
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTD1200_DNA
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size35162592
Sequencing Scaffolds5
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella montpellierensis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Water From Within Volcano Caldera → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → volcano → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAxial Seamount, northeast Pacific Ocean
CoordinatesLat. (o)45.9332Long. (o)-129.9988Alt. (m)N/ADepth (m)1200
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025488Metagenome / Metatranscriptome201N
F048174Metagenome / Metatranscriptome148Y
F058997Metagenome / Metatranscriptome134N
F075867Metagenome / Metatranscriptome118N
F076005Metagenome / Metatranscriptome118N
F087089Metagenome / Metatranscriptome110N
F101016Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0081982_102959Not Available544Open in IMG/M
Ga0081982_115150All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria824Open in IMG/M
Ga0081982_130220Not Available1104Open in IMG/M
Ga0081982_154950Not Available535Open in IMG/M
Ga0081982_165178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella montpellierensis548Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0081982_102959Ga0081982_1029592F058997LLDERIMIIYKGREMTVREACALMGIDCDDFMAWCKKFALQNYSYALNYYKRTLKFKK*
Ga0081982_111118Ga0081982_1111181F025488MAYVSRGFIPQTSLAANLGFTRPMYIPAGNGTATALYDIVKVSTSGSTVDTAGVPAGLMGCVRVSDKDDVPCGVIVGFIADPDYLNQTYRSSSTARVALVNYDPQVVLEAQEDDNGTTLAVARIGTPVDLVPGSIDT
Ga0081982_115150Ga0081982_1151502F101016ANAEAKRLELQLRLMEVESKARLENAQVKKTEAEALKTMADVEVMYNDAQKRQADQLLEELTALPAALPTSEELLDEQSIDSGEGEYSGLPPMVEQSSDQGDDGAIDQRVDEPQQPNEPPQSIDIGEGTLPIGQGAGIDGGAGLQEPTNGDMQEGV*
Ga0081982_130220Ga0081982_1302201F075867MNPALKPSTKHFLQYDTATFEHEGFKTLNGRISQLALEPRFWSVSVKVITENYEGTEKIKDHFNFKTSERCKLSDLRDQVKKEVLDKDDYLPVCTQCLVTARVMM*
Ga0081982_130220Ga0081982_1302203F048174MSDKGQSNNKDVQSHSEVVEALLKGEIERLKDDLDRLHRERDAFSRQCSVMAEENQQWEQDSKRLTWMIQNHGRVEFEFNANCYVTFIHKNEFKATLGSDDTRVEIDRAMEMCK*
Ga0081982_154950Ga0081982_1549501F076005MKHFKVRVQYLNGIDFLFECDAVTAWQAGALARVAGRIAGMGGAMDVKETIVQEVSAM
Ga0081982_165178Ga0081982_1651781F087089NNVQTIVFIENKANRELIKGIFGDTVLKKFDRVLVDAKRDRLGSTLGGVGGSQTYGRGATDKIMSQSIWKLDGAGASLGALLGTMLGGVGTMGGALGGAATAHGVKVLNMKQNALTSKAMLDPKYAAELLKKQIAPTQYKRGALESLKKNLAPSTIPVQDKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.