Sample 3300005759

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005759

3300005759: Scenedesmus quadricauda associated microbial communities from Germany - MZCH: 10104

Overview

Basic Information
IMG/M Taxon OID	3300005759 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114429 \| Gp0111437 \| Ga0078192
Sample Name	Scenedesmus quadricauda associated microbial communities from Germany - MZCH: 10104
Sequencing Status	Permanent Draft
Sequencing Center	HPI Heinrich-Pette-Institut
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	168690013
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Genome Analysis Of Scenedesmus Quadricauda 10104 And Associated Bacterial Communtity
Type	Host-Associated
Taxonomy	Host-Associated → Algae → Green Algae → Unclassified → Unclassified → Scenedesmus Quadricauda Associated → Genome Analysis Of Scenedesmus Quadricauda 10104 And Associated Bacterial Communtity

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Germany: Hamburg
Coordinates	Lat. (^o)	53.560155	Long. (^o)	9.859606	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093954	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0078192_101130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	24762	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0078192_101130	Ga0078192_10113016	F093954	MNYVPPEKPVPESIAASLARSEAQIAEGRTVPLEPVLARLRSSIARMQARPETSAPKE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.