Sample 3300005671

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005671

3300005671: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90106 Phage Sequencing

Overview

Basic Information
IMG/M Taxon OID	3300005671 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111422 \| Gp0115855 \| Ga0074420
Sample Name	Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90106 Phage Sequencing
Sequencing Status	Permanent Draft
Sequencing Center	University of Queensland
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	5812671
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia
Type	Engineered
Taxonomy	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	St. Lucia, Queensland Australia
Coordinates	Lat. (^o)	-27.49999	Long. (^o)	153.012098	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002371	Metagenome / Metatranscriptome	566	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0074420_10752	Not Available	827	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074420_10752	Ga0074420_107522	F002371	MKNKQETRGGTRKKAGAKPKYNEQTKTVAFRCPMSKVDELKLIVKSKLSEWSLK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.